(data stored in ACNUC9543 zone)

EMBL: CP000308.PE226

CP000308.PE226       Location/Qualifiers
FT   CDS             complement(263086..265419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12195"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSJ4"
FT                   /protein_id="ABG12195.1"
FT                   /translation="MAYYSKINHSLLFTLALFTLKLAHAEAVKIEYLVPMGFSAAEENN
FT                   SLQLLGVLDSKTLPSPITFSEEEQQLQFNQQNYRHNNISEESIILLGEILSQIPYLQCK
FT                   TGCDYTLSGHRVALDKVNNTLTITNNNNRYLMPTTTWGLVSNQSLDLRMTAAHYRAMSV
FT                   RGQSYIGLPWQSYGFASWFYNAIQSQNTLQSQNTMPSQSTYQPVNRPQYQRLTQKGIGS
FT                   WYLQKNFSALYLRTGRQNNLDNNAGSVHTLINPALDQFVTLGSQSYLAIDKPSTGSIVL
FT                   YAAQDGDYEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYNVEIRLVDRLGRIVSQENQT
FT                   ISNIGNQTNNGWFLTMGKGPAKGKKTPRLVQFGRSRVIESVQTNITLLKDDAHHWAVEA
FT                   NVSRPLSLNKVNITPTGGLMSGEKRSGGYVRLNGGNNTLGYFSLARYQSPYVSRYAPDS
FT                   GSTSGSYTRRIGPTQLSYQFNQYRNNRQHRIQSGWDWQLPQFNLALSLGLQNGGQWNSH
FT                   NNYGVFLNTTLSFGQSNASINTAYTQQQLNTSASYQKEFIDNYGASTLGVSGSASGKLN
FT                   SVGGFAKRSGSRGDISGRVGIDNQITNGGISYNGMLALSSQGVALGRSSYSGAALLIKA
FT                   PALGGTPYSFHVEDSPITGGGTYAIPVPRYQDRFFVRTHTDRSDMDMNIQLPVNIVRAH
FT                   PGQVFSGEADITLNLLYSGFLKNAQGLPVSGVIEETGDTAYPNGLFSINAQNRLQAITV
FT                   HGPSGRYRCDMHSQPTHIYLCHAD"
     MAYYSKINHS LLFTLALFTL KLAHAEAVKI EYLVPMGFSA AEENNSLQLL GVLDSKTLPS        60
     PITFSEEEQQ LQFNQQNYRH NNISEESIIL LGEILSQIPY LQCKTGCDYT LSGHRVALDK       120
     VNNTLTITNN NNRYLMPTTT WGLVSNQSLD LRMTAAHYRA MSVRGQSYIG LPWQSYGFAS       180
     WFYNAIQSQN TLQSQNTMPS QSTYQPVNRP QYQRLTQKGI GSWYLQKNFS ALYLRTGRQN       240
     NLDNNAGSVH TLINPALDQF VTLGSQSYLA IDKPSTGSIV LYAAQDGDYE IYRDNQLIRR       300
     IPAQLGRNEI DYSQLPGGYY NVEIRLVDRL GRIVSQENQT ISNIGNQTNN GWFLTMGKGP       360
     AKGKKTPRLV QFGRSRVIES VQTNITLLKD DAHHWAVEAN VSRPLSLNKV NITPTGGLMS       420
     GEKRSGGYVR LNGGNNTLGY FSLARYQSPY VSRYAPDSGS TSGSYTRRIG PTQLSYQFNQ       480
     YRNNRQHRIQ SGWDWQLPQF NLALSLGLQN GGQWNSHNNY GVFLNTTLSF GQSNASINTA       540
     YTQQQLNTSA SYQKEFIDNY GASTLGVSGS ASGKLNSVGG FAKRSGSRGD ISGRVGIDNQ       600
     ITNGGISYNG MLALSSQGVA LGRSSYSGAA LLIKAPALGG TPYSFHVEDS PITGGGTYAI       660
     PVPRYQDRFF VRTHTDRSDM DMNIQLPVNI VRAHPGQVFS GEADITLNLL YSGFLKNAQG       720
     LPVSGVIEET GDTAYPNGLF SINAQNRLQA ITVHGPSGRY RCDMHSQPTH IYLCHAD          777
//

If you have problems or comments...

PBIL Back to PBIL home page