(data stored in ACNUC9543 zone)

EMBL: CP000308.PE227

CP000308.PE227       Location/Qualifiers
FT   CDS             complement(265686..266294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12196"
FT                   /db_xref="GOA:A0A0H2Y3X4"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3X4"
FT                   /protein_id="ABG12196.1"
FT                   /translation="MSRNYLTPSFYITPPTSTLINHNAIPFWMGFYIKDYQVFMMKKTV
FT                   IAIITMATLTSTAAYANTIEKDIRVEAEIISLMDVKRADDSNINKIKLTYDTVTNDGTY
FT                   SHSEAIKVKARKQLGDKLKVSLAAPVILSEPNNNKEFTHVEVLLDGKKLLETADTRDLI
FT                   AFHGSELNAELKVSAKEPNNAVGGEKYSGVIQLRLEPSA"
     MSRNYLTPSF YITPPTSTLI NHNAIPFWMG FYIKDYQVFM MKKTVIAIIT MATLTSTAAY        60
     ANTIEKDIRV EAEIISLMDV KRADDSNINK IKLTYDTVTN DGTYSHSEAI KVKARKQLGD       120
     KLKVSLAAPV ILSEPNNNKE FTHVEVLLDG KKLLETADTR DLIAFHGSEL NAELKVSAKE       180
     PNNAVGGEKY SGVIQLRLEP SA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page