(data stored in ACNUC9543 zone)

EMBL: CP000308.PE23

CP000308.PE23        Location/Qualifiers
FT   CDS             complement(36583..38082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0023"
FT                   /product="hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11992"
FT                   /db_xref="GOA:A0A0H2Y306"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y306"
FT                   /protein_id="ABG11992.1"
FT                   /translation="MNYLVRPPPPAPVLPEDTQCLPINGVYIQGITLLTEDDLSELSAI
FT                   PEQCIHPDNINLLTRELTHIYMDKGYITARIQFIPPDADGKLGLDITEGFVEAIDSTDT
FT                   GLDGETVFPNMIGKPLNITRLDQGLDQANRLPSNKVTVDILPGTLPGGSILKLHNTPST
FT                   PWHLTTSMDNYGNKNTGKWLSRNALSFDNPLGLSDSVSINISNTVDRPQHNYSRAYSMF
FT                   YSVPYGALTFSGFGSYAEYRYPMKLQFNTAKLHGETQQHGLRADYVFYRDQSQINGLSA
FT                   QLTYKRASNYLNEEKIAISSPTLTIFELGLNHLHVLPMGLFNINVSLEQGLPWLGAERS
FT                   NGPLANYQDSQFTKAKTSITSNHYFALFDDTYLFSNQFYGQYTRDRLPGVEWLSITDSS
FT                   AIRGFSRNTLSADQGWYLQNTLSRRFTLGDATLTPRVGLDTGRLQQKPQGWVSAMGLSA
FT                   GVSLNYQNATLDIEASRGRLLSGPSKINDPTQILARFSYRF"
     MNYLVRPPPP APVLPEDTQC LPINGVYIQG ITLLTEDDLS ELSAIPEQCI HPDNINLLTR        60
     ELTHIYMDKG YITARIQFIP PDADGKLGLD ITEGFVEAID STDTGLDGET VFPNMIGKPL       120
     NITRLDQGLD QANRLPSNKV TVDILPGTLP GGSILKLHNT PSTPWHLTTS MDNYGNKNTG       180
     KWLSRNALSF DNPLGLSDSV SINISNTVDR PQHNYSRAYS MFYSVPYGAL TFSGFGSYAE       240
     YRYPMKLQFN TAKLHGETQQ HGLRADYVFY RDQSQINGLS AQLTYKRASN YLNEEKIAIS       300
     SPTLTIFELG LNHLHVLPMG LFNINVSLEQ GLPWLGAERS NGPLANYQDS QFTKAKTSIT       360
     SNHYFALFDD TYLFSNQFYG QYTRDRLPGV EWLSITDSSA IRGFSRNTLS ADQGWYLQNT       420
     LSRRFTLGDA TLTPRVGLDT GRLQQKPQGW VSAMGLSAGV SLNYQNATLD IEASRGRLLS       480
     GPSKINDPTQ ILARFSYRF                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page