(data stored in ACNUC9543 zone)

EMBL: CP000308.PE233

CP000308.PE233       Location/Qualifiers
FT   CDS             272005..272931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0233"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12202"
FT                   /db_xref="GOA:A0A0E1NM42"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM42"
FT                   /protein_id="ABG12202.1"
FT                   /translation="MPAFVVSLWHQIVLSSPLFVLLALGYALVRFGKWPSTITDGLTRF
FT                   VFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFIIGRVIAKRVFHLDGVSGSV
FT                   FALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGSPTM
FT                   AGFVKTTRSVLTNPLIIGIISGTLFSLTGLHLPVFIDQPVSMLGQVAPPLSLIVLGMGL
FT                   AEYRVTEGWQISTAICFLKLIVQPMVIWALAWAMDLPALETQVVVLLGSMATGVNVYLM
FT                   SRQFNVLTGPAAASLVIQRYWPPSPRH"
     MPAFVVSLWH QIVLSSPLFV LLALGYALVR FGKWPSTITD GLTRFVFSLA LPAMLFRMMC        60
     DFSERPAVDA RLLIAFFGSC LVVFIIGRVI AKRVFHLDGV SGSVFALGGI FSNNVMLGLP       120
     IATIMLGEKS IPAVALVLVF NGLILWTLVT ISVEWARNGS PTMAGFVKTT RSVLTNPLII       180
     GIISGTLFSL TGLHLPVFID QPVSMLGQVA PPLSLIVLGM GLAEYRVTEG WQISTAICFL       240
     KLIVQPMVIW ALAWAMDLPA LETQVVVLLG SMATGVNVYL MSRQFNVLTG PAAASLVIQR       300
     YWPPSPRH                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page