(data stored in ACNUC9543 zone)

EMBL: CP000308.PE234

CP000308.PE234       Location/Qualifiers
FT   CDS             273280..274212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0234"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12203"
FT                   /db_xref="GOA:A0A0H2Y4V7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4V7"
FT                   /protein_id="ABG12203.1"
FT                   /translation="MHFTLSLSQFIVLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLM
FT                   RVGLAALVFLPFLRWRNIPWRVILLYMAVGSIQLGIMYLFSFRAYLYLTVPEFLLFTVM
FT                   TPLYVTLIYDLLRRQRLRWGYALSALLAVLGAAIIRYDQLSEHFWWGLALVQAANICFA
FT                   IGQVGYKRLMEVHPIPQHVAFSWFYLGAFVVAVVAWFAFGNPQRLPTTGLQWGILVWLG
FT                   VGASALGYFMWNYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAAVIM
FT                   ASLWVHRRWIAPHPLQTANDRKRADEQNE"
     MHFTLSLSQF IVLLLVITTI LWAFSFSLIG EYLAGQVDSW FSVLMRVGLA ALVFLPFLRW        60
     RNIPWRVILL YMAVGSIQLG IMYLFSFRAY LYLTVPEFLL FTVMTPLYVT LIYDLLRRQR       120
     LRWGYALSAL LAVLGAAIIR YDQLSEHFWW GLALVQAANI CFAIGQVGYK RLMEVHPIPQ       180
     HVAFSWFYLG AFVVAVVAWF AFGNPQRLPT TGLQWGILVW LGVGASALGY FMWNYGATQV       240
     DAGTLGIMNN VHVPAGLLVN LAIWQEKPHW PSFIIGAAVI MASLWVHRRW IAPHPLQTAN       300
     DRKRADEQNE                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page