(data stored in ACNUC9543 zone)

EMBL: CP000308.PE240

CP000308.PE240       Location/Qualifiers
FT   CDS             280866..282677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0240"
FT                   /product="putative carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12209"
FT                   /db_xref="GOA:A0A0E1NPD4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPD4"
FT                   /protein_id="ABG12209.1"
FT                   /translation="MQHAITFVIASACILTICYRLYGIFFVRKVLRVDDSEVTPSHTFE
FT                   DGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAVHDTV
FT                   VLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNPWGT
FT                   FAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEGTWLGEWLMLKADT
FT                   VSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQFPAVTQFI
FT                   HGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAECM
FT                   VGVMALIAATSLHPADYFAINSSAEAWSALGMEVVNLPKLSEEIGLDLYGRTGGAVTLA
FT                   VGMTDIFIRVPWFNSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQDFLGDIWAPLK
FT                   RTDWLPGTLVCSVIACALWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRLAT
FT                   KRVYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIISIIMMTLGVIILI
FT                   SALRKWRELWIRRSAEMAGNKVVTANA"
     MQHAITFVIA SACILTICYR LYGIFFVRKV LRVDDSEVTP SHTFEDGKDY VPTKKWVNFG        60
     SHFAAIAAAG PLVGPVLAAQ YGYLPGFLWL LIGCVIGGAV HDTVVLFASM KHQGKSLSEV       120
     AKSELGPVAG WCTGLAMLFI ITITMAGLSM VVVHALERNP WGTFAVFMTI PIAICVGLWE       180
     RMTGSMKGAS YVGIAAIMVC VFVGPYIEGT WLGEWLMLKA DTVSIILPMY AFFATALPVW       240
     MLLTPRGYLS SFMKIGVFGA LIVGVVFINP EIQFPAVTQF IHGGGPVLAG PVWPFISITI       300
     ACGAISGFHA FIGSGTTPKQ IDKWSDILPV GFGAMLAECM VGVMALIAAT SLHPADYFAI       360
     NSSAEAWSAL GMEVVNLPKL SEEIGLDLYG RTGGAVTLAV GMTDIFIRVP WFNSLAAYFF       420
     QFVVMFEAVF ILTAVDSGTR VARYLLQDFL GDIWAPLKRT DWLPGTLVCS VIACALWGYL       480
     LNSGDINSVW ALFGVSNQLM ASVGLIIGAT IILRLATKRV YMLTCVIPLA YLFVTVNYAG       540
     YWMITHVYFN SAAKGYNLFN GIISIIMMTL GVIILISALR KWRELWIRRS AEMAGNKVVT       600
     ANA                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page