(data stored in ACNUC9543 zone)

EMBL: CP000308.PE242

CP000308.PE242       Location/Qualifiers
FT   CDS             283687..285192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0242"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12211"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVM4"
FT                   /protein_id="ABG12211.1"
FT                   /translation="MDISLFYGLGGCLVGGLIGWLIASLSQQRTKAQQDIERRLLEQAL
FT                   QQAQQSIATLQMTQQRNEQQLRQSELEQRNLHSQLAANSEKLQQLAHWRNECEQLNQEL
FT                   RAQREINSAQEAELREVTIRLEETRLATEEKQRLLLNSEQRLTTQFENLANRIFEQTGR
FT                   RADEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMARE
FT                   ALNLTKALKGDNKTQGNWGEVVLAKVLEASGLREGHEYQTQVSVKIDQTSRMQPDVIVR
FT                   LPQGKDVVIDAKMSLVAYERYFNSEDDAEREVALNEHLSSLRGHIRMLGRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLVAIDRQPELINEALQHNIMLVSPTTLLVALRTITNLWRYEHQ
FT                   SQNAQRIAERAARLYDKVRLFVDDMASLGQSLDKAQLSYHQAMNKLSQGRGNLVGQVES
FT                   FRTLGVEVKRPISPLLAEKACAEHQPEGDLALSDDAESGAFPE"
     MDISLFYGLG GCLVGGLIGW LIASLSQQRT KAQQDIERRL LEQALQQAQQ SIATLQMTQQ        60
     RNEQQLRQSE LEQRNLHSQL AANSEKLQQL AHWRNECEQL NQELRAQREI NSAQEAELRE       120
     VTIRLEETRL ATEEKQRLLL NSEQRLTTQF ENLANRIFEQ TGRRADEQNK QSLDRLLLPL       180
     REQLDGFRRQ VQDSFGQEAR ERHTLTHEIR NLQQLNAQMA REALNLTKAL KGDNKTQGNW       240
     GEVVLAKVLE ASGLREGHEY QTQVSVKIDQ TSRMQPDVIV RLPQGKDVVI DAKMSLVAYE       300
     RYFNSEDDAE REVALNEHLS SLRGHIRMLG RKDYQQLPGL RSLDYVLMFI PVEPAFLVAI       360
     DRQPELINEA LQHNIMLVSP TTLLVALRTI TNLWRYEHQS QNAQRIAERA ARLYDKVRLF       420
     VDDMASLGQS LDKAQLSYHQ AMNKLSQGRG NLVGQVESFR TLGVEVKRPI SPLLAEKACA       480
     EHQPEGDLAL SDDAESGAFP E                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page