(data stored in ACNUC9543 zone)

EMBL: CP000308.PE244

CP000308.PE244       Location/Qualifiers
FT   CDS             286053..286703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12213"
FT                   /db_xref="GOA:A0A0E1NLQ5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLQ5"
FT                   /protein_id="ABG12213.1"
FT                   /translation="MSLRTLMLKPFLLKPRLLTPLITAALETVLNGVLFNDKSLKAARS
FT                   RLVGKVLRIELREINFPLLFVFSERQVDVLSQWDDAADCLVKTDVAVLARLRDRQQLSP
FT                   LMRTGELVVEGDIQVVQQLVALLDLAEWDLAEWLAPYVGDVAAESLGQAIHKSSGFLSR
FT                   QLRQQQHYLAEAITEEWRMAPNLLEVMWFHEEVDATARATEALSSRLATMETK"
     MSLRTLMLKP FLLKPRLLTP LITAALETVL NGVLFNDKSL KAARSRLVGK VLRIELREIN        60
     FPLLFVFSER QVDVLSQWDD AADCLVKTDV AVLARLRDRQ QLSPLMRTGE LVVEGDIQVV       120
     QQLVALLDLA EWDLAEWLAP YVGDVAAESL GQAIHKSSGF LSRQLRQQQH YLAEAITEEW       180
     RMAPNLLEVM WFHEEVDATA RATEALSSRL ATMETK                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page