(data stored in ACNUC9543 zone)

EMBL: CP000308.PE247

CP000308.PE247       Location/Qualifiers
FT   CDS             288784..289446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0247"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12216"
FT                   /db_xref="GOA:Q1CBF6"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBF6"
FT                   /protein_id="ABG12216.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAAT
FT                   VQNELAQELKLQELQDSLKKVEQAGLQNLTPELKASMDELKEAAEALKRSYHVDAGSEA
FT                   PHTIHNPLVTEPEAIHDGVTPAEPATQVSALAQAPNILEAGTASVVDSVVEAAPVTTVK
FT                   SVVQGEVLVKSTPVQEVGLADVMDKPVTKQQIDTIDSHGTDLSSAGPSRIHQPGGDQ"
     MFDIGFSELL LVLVIGLVVL GPERLPVAVR TVSGWIRTLR SLAATVQNEL AQELKLQELQ        60
     DSLKKVEQAG LQNLTPELKA SMDELKEAAE ALKRSYHVDA GSEAPHTIHN PLVTEPEAIH       120
     DGVTPAEPAT QVSALAQAPN ILEAGTASVV DSVVEAAPVT TVKSVVQGEV LVKSTPVQEV       180
     GLADVMDKPV TKQQIDTIDS HGTDLSSAGP SRIHQPGGDQ                             220
//

If you have problems or comments...

PBIL Back to PBIL home page