(data stored in ACNUC9543 zone)

EMBL: CP000308.PE248

CP000308.PE248       Location/Qualifiers
FT   CDS             289449..290225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0248"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12217"
FT                   /db_xref="GOA:A0A0E1NNF6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNF6"
FT                   /protein_id="ABG12217.1"
FT                   /translation="MAVDDTQPLISHLIELRKRLLNCIITILVVFLVLVFFANDIYNLV
FT                   SAPLIKQLPAGASMIATDVASPFFTPIKLTMMVSVFVSAPMTLYQVWAFIAPALYKHER
FT                   RLMVPLLISSSLLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMALFM
FT                   AFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVGAFVVGMLLTPPDVLSQTLLAIPM
FT                   YLLFEVGVFFARFYTGKQRRAATEEDEGIDSHPKAP"
     MAVDDTQPLI SHLIELRKRL LNCIITILVV FLVLVFFAND IYNLVSAPLI KQLPAGASMI        60
     ATDVASPFFT PIKLTMMVSV FVSAPMTLYQ VWAFIAPALY KHERRLMVPL LISSSLLFYL       120
     GMAFAYFVVF PLAFGFFAKT APESVLIATD ITKYLDFVMA LFMAFGISFE VPIAIILLCW       180
     AGVTTPEALK KKRPYVFVGA FVVGMLLTPP DVLSQTLLAI PMYLLFEVGV FFARFYTGKQ       240
     RRAATEEDEG IDSHPKAP                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page