(data stored in ACNUC9543 zone)

EMBL: CP000308.PE249

CP000308.PE249       Location/Qualifiers
FT   CDS             290281..290820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0249"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12218"
FT                   /db_xref="GOA:A0A0E1NTF9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF9"
FT                   /protein_id="ABG12218.1"
FT                   /translation="MFDIGVNLTSVQFAKDYHQVVNRAKEAGVLGILITGTDADESLAA
FT                   QTLAAEYPGYCWSTTGVHPHHASSWQDSVEQKIRTLAATASVVGIGECGLDFNRNFSTP
FT                   AQQEVAFTAQLALAAELSLPVFLHCRDAHERFIDLLVPWLDKIPAAVVHCFTGNSDCNE
FT                   RCNSDPHPTPEIRSRG"
     MFDIGVNLTS VQFAKDYHQV VNRAKEAGVL GILITGTDAD ESLAAQTLAA EYPGYCWSTT        60
     GVHPHHASSW QDSVEQKIRT LAATASVVGI GECGLDFNRN FSTPAQQEVA FTAQLALAAE       120
     LSLPVFLHCR DAHERFIDLL VPWLDKIPAA VVHCFTGNSD CNERCNSDPH PTPEIRSRG        179
//

If you have problems or comments...

PBIL Back to PBIL home page