(data stored in ACNUC9543 zone)

EMBL: CP000308.PE255

CP000308.PE255       Location/Qualifiers
FT   CDS             complement(295382..296713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0255"
FT                   /product="ATP-binding heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12224"
FT                   /db_xref="GOA:Q1CBE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE8"
FT                   /protein_id="ABG12224.1"
FT                   /translation="MSEMTPREIVSELDSHIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGVPDESQEPSATRQTFRKKL
FT                   REGQLDDKEIEIDLAAAPMGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAL
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTIEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESSGQSITIDAEYVGKHLDELVADEDLSRFIL"
     MSEMTPREIV SELDSHIIGQ DKAKRAVAIA LRNRWRRMQL NEELRHEVTP KNILMIGPTG        60
     VGKTEIARRL AKLANAPFIK VEATKFTEVG YVGKEVDSII RDLTDAAVKM VRHQSIEKMR       120
     YRAEELAEER ILDVLIPPAK NNWGVPDESQ EPSATRQTFR KKLREGQLDD KEIEIDLAAA       180
     PMGVEIMAPP GMEEMTNQLQ SMFQNIAGQK QKPRKIKIKE ALKLLIEEEA AKLVNPEELK       240
     QQAIDAVEQH GIVFIDEIDK ICKRGQTSGP DVSREGVQRD LLPLVEGCTV STKHGMVKTD       300
     HILFIASGAF QVSSPSDLIP ELQGRLPIRV ELQALTTDDF ERILTEPSAS LTEQYKALMA       360
     TEGVTIEFTR EGIRKIAEAA WQVNERTENI GARRLHTVLE RLMEDISYDA SESSGQSITI       420
     DAEYVGKHLD ELVADEDLSR FIL                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page