(data stored in ACNUC9543 zone)

EMBL: CP000308.PE257

CP000308.PE257       Location/Qualifiers
FT   CDS             complement(297408..298154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0257"
FT                   /product="cell division protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12226"
FT                   /db_xref="GOA:A0A0E1NPB1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPB1"
FT                   /protein_id="ABG12226.1"
FT                   /translation="MALAVALLVVFVGGLYFITHNKPGELPLLPNHDPRTGNGLPPKPE
FT                   ERWRYIKELENRQIGVPMPTEPSAGGEVNAKTELTNEQRQLLEQMQADMRQQPTQLSEV
FT                   PYNQGMQQVPRSAVTIKPPATSVQPQPVTPPRQTTIPVQPQAPAPVRTPPAAPVTQAVT
FT                   PPKVEKEKEKTQRWMVQCGSFKAVDQAESIRAQLAFAGIESRITSGGGWNRVVLGPYNS
FT                   KAAADKALQRLQGAGQSGCIPLSVGG"
     MALAVALLVV FVGGLYFITH NKPGELPLLP NHDPRTGNGL PPKPEERWRY IKELENRQIG        60
     VPMPTEPSAG GEVNAKTELT NEQRQLLEQM QADMRQQPTQ LSEVPYNQGM QQVPRSAVTI       120
     KPPATSVQPQ PVTPPRQTTI PVQPQAPAPV RTPPAAPVTQ AVTPPKVEKE KEKTQRWMVQ       180
     CGSFKAVDQA ESIRAQLAFA GIESRITSGG GWNRVVLGPY NSKAAADKAL QRLQGAGQSG       240
     CIPLSVGG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page