(data stored in ACNUC9543 zone)

EMBL: CP000308.PE260

CP000308.PE260       Location/Qualifiers
FT   CDS             302141..302356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0260"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12229"
FT                   /db_xref="GOA:Q1CBE3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE3"
FT                   /protein_id="ABG12229.1"
FT                   /translation="MKQGIHPKYEQVTASCSCGNVIKINSTVGHDLNLDVCGECHPFYT
FT                   GKQRDVASGGRVDRFNKRFSVPGAKK"
     MKQGIHPKYE QVTASCSCGN VIKINSTVGH DLNLDVCGEC HPFYTGKQRD VASGGRVDRF        60
     NKRFSVPGAK K                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page