(data stored in ACNUC9543 zone)

EMBL: CP000308.PE262

CP000308.PE262       Location/Qualifiers
FT   CDS             complement(303685..304002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0262"
FT                   /product="transcriptional repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12231"
FT                   /db_xref="GOA:Q1CBE1"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBE1"
FT                   /protein_id="ABG12231.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
     MAEWNGEYVS PYAEHGKKSK QVKKITVSIP LKVLKILTDE RTRRQVNNLR HATNSELLCE        60
     AFLHAFTGQP LPNDEDLRKE RSDEIPEAAK ILMRELGVDP DTWEY                       105
//

If you have problems or comments...

PBIL Back to PBIL home page