(data stored in ACNUC9543 zone)

EMBL: CP000308.PE263

CP000308.PE263       Location/Qualifiers
FT   CDS             304380..305369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12232"
FT                   /db_xref="GOA:A0A0E1P079"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P079"
FT                   /protein_id="ABG12232.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRTHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSALHLVCTTFLQPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYRVLFVDQGDEAALNCALAEKPKLVLIETPSNPLLRVVDIAAICQAA
FT                   RAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAVIAKDPELVVEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLP
FT                   QHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGG"
     MTRKQATIAV RSGLNDDEQY GCVVPPIHLS STYNFIDFNQ PRTHDYSRRG NPTRDVVQRA        60
     LAELEGGAGA VMTSSGMSAL HLVCTTFLQP GDLLVAPHDC YGGSYRLFDS LSKRGAYRVL       120
     FVDQGDEAAL NCALAEKPKL VLIETPSNPL LRVVDIAAIC QAARAAGALT VCDNTFLSPA       180
     LQQPLSLGAD LVVHSCTKYL NGHSDVVAGA VIAKDPELVV ELAWWANNIG VTGAAFDSYL       240
     LLRGLRTLSP RMAQQQRNAD DIVRYLQQQP LVKKLYHPSL PQHPGHEIAC RQQSGFGAML       300
     SFELDGDEQV MRRFLSALEL FTLAESLGG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page