(data stored in ACNUC9543 zone)

EMBL: CP000308.PE269

CP000308.PE269       Location/Qualifiers
FT   CDS             310898..312322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0269"
FT                   /product="Sodium:galactoside symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12238"
FT                   /db_xref="GOA:A0A0E1NRH0"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRH0"
FT                   /protein_id="ABG12238.1"
FT                   /translation="MSLDSQHLCSLKDEGDKRLKINMNNSGMKIPMKELASYFGYGMGQ
FT                   CFSFGLVGTFILFFYTDIMGISPVAASMIFLIARVWDAIHDPLIAGVMDTINMRRGKFR
FT                   PYLLFTPFLIFLVTVAAFYNIEASLMTKTIYAGVTYILWGTLYALSDIPFWSMSTVMTD
FT                   EPQERAKTATCAMLGVNAGIGATMILFPYISGLFAENSADRGYFAGVVILMVLGVILML
FT                   NGFFNTKERVNVTVTEKVTLKQTFIVVWQNKPLFFILSAFFMNVFSNIVNTFYIFFFTY
FT                   NMGDAELVSVIGLITFTCALACLGTPFLTRHFKKRDLFITLCVLEIIARVGFWFTGYNN
FT                   VVSVMVWLTVITAIFMMTNPLISAMIADTVEYSYYHTGKRCAAITFSGQTFVGKLSVAV
FT                   AGGVSGLILSILGYMPNVAQSTWTLNGLFFCISLLPAVGAVVRILIMRKYKFTEDEHAI
FT                   LREELKQGRFHSSVGK"
     MSLDSQHLCS LKDEGDKRLK INMNNSGMKI PMKELASYFG YGMGQCFSFG LVGTFILFFY        60
     TDIMGISPVA ASMIFLIARV WDAIHDPLIA GVMDTINMRR GKFRPYLLFT PFLIFLVTVA       120
     AFYNIEASLM TKTIYAGVTY ILWGTLYALS DIPFWSMSTV MTDEPQERAK TATCAMLGVN       180
     AGIGATMILF PYISGLFAEN SADRGYFAGV VILMVLGVIL MLNGFFNTKE RVNVTVTEKV       240
     TLKQTFIVVW QNKPLFFILS AFFMNVFSNI VNTFYIFFFT YNMGDAELVS VIGLITFTCA       300
     LACLGTPFLT RHFKKRDLFI TLCVLEIIAR VGFWFTGYNN VVSVMVWLTV ITAIFMMTNP       360
     LISAMIADTV EYSYYHTGKR CAAITFSGQT FVGKLSVAVA GGVSGLILSI LGYMPNVAQS       420
     TWTLNGLFFC ISLLPAVGAV VRILIMRKYK FTEDEHAILR EELKQGRFHS SVGK             474
//

If you have problems or comments...

PBIL Back to PBIL home page