(data stored in ACNUC9543 zone)

EMBL: CP000308.PE27

CP000308.PE27        Location/Qualifiers
FT   CDS             42376..42783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0027"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11996"
FT                   /db_xref="GOA:Q1CC26"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CC26"
FT                   /protein_id="ABG11996.1"
FT                   /translation="MAKNSRSQWIAKNLQRLLNVGLIMLAAILVVFLVKETIHLGKVLF
FT                   LSNQETSSYMLIEGIVIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ENPIDTLIYSGSILVLVVTLYLANTERLKRE"
     MAKNSRSQWI AKNLQRLLNV GLIMLAAILV VFLVKETIHL GKVLFLSNQE TSSYMLIEGI        60
     VIYFLYFEFI ALIVKYFESG YHFPLRYFIY IGITAIIRLI IVDHENPIDT LIYSGSILVL       120
     VVTLYLANTE RLKRE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page