(data stored in ACNUC9543 zone)

EMBL: CP000308.PE271

CP000308.PE271       Location/Qualifiers
FT   CDS             complement(314833..316161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0271"
FT                   /product="putative siderophore biosynthesis protein IucD"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12240"
FT                   /db_xref="GOA:A0A0E1NPY0"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPY0"
FT                   /protein_id="ABG12240.1"
FT                   /translation="MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPG
FT                   MMVPDCHMQTCFLKDLVSTVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLR
FT                   WAASGMSSLEFSQDIQSVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQN
FT                   DRCFHASEMALRNPDLTGKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNA
FT                   LDEAAFANEYFMPEYVESFYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEV
FT                   LHEKPWARLLPSRSLTNMHTRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFL
FT                   DPLADRLQTTADCQYQVAPDFVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAH
FT                   ILNRALGRTQFDLTSTPAVIQWRSQQSGVPAHPEHPVLNCIDI"
     MNQPLDFIGI GIGPFNLSIA ALGSEVSGFN SKFLERKPHF SWHPGMMVPD CHMQTCFLKD        60
     LVSTVSPTNT YSFLNYLVQH KKFYRFLTTE HRTVSREEFA DYLRWAASGM SSLEFSQDIQ       120
     SVDFDDQQRH FVVTTPRNVY HARHVCLGIG KRIKLPDCVT EQNDRCFHAS EMALRNPDLT       180
     GKRVTIVGGG QSGADLFLNI FLAAWGQPKQ LNWISRRNNY NALDEAAFAN EYFMPEYVES       240
     FYTLNDSAKQ HMLAEQRMTS DGITSESLLA IYRAMYHQFE VLHEKPWARL LPSRSLTNMH       300
     TRGNGYQLLT HHHLDQGTET FDTDVVIFAT GYQQDRPAFL DPLADRLQTT ADCQYQVAPD       360
     FVLDWQGPRE NCLFAVNAGM HSHGIAEPQL SLMAWRSAHI LNRALGRTQF DLTSTPAVIQ       420
     WRSQQSGVPA HPEHPVLNCI DI                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page