(data stored in ACNUC9543 zone)

EMBL: CP000308.PE274

CP000308.PE274       Location/Qualifiers
FT   CDS             complement(318837..319907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0274"
FT                   /product="siderophore biosynthesis protein, IucA familly"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12243"
FT                   /db_xref="GOA:A0A0E1NRJ8"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRJ8"
FT                   /protein_id="ABG12243.1"
FT                   /translation="MHPWQADHLLKQDWCQQLVQQNALHDLGEAGERWLPTSSSRSLYS
FT                   PSNRDMVKFSLSVRLTNSVRTLSVKEAKRGMRLARLAQTPRWQELQARYPTFRVMQEDG
FT                   WAGLRSADFTLQEESLLVLRDNLLFSQPDSQTNVLVTLTQAAPDGGDSLLASAVRRLAA
FT                   RLNLPLQQAAFCWLDAYCQHVLLPLFSTEADYGLVLLAHQQNILVEMQQDLPVGMLYRD
FT                   CQGSGFTQSALPWLAEIGEAEAENSFSEQQLLRYFPYYLLVNSSLAVTAALAAAGFDSE
FT                   ENLMVRVRDALSALRTCAKNTLCLDYVLDSPHWHCKGNFFCYLHDHNENTIVDPAVIYF
FT                   DFVNPLHQGVIHGATR"
     MHPWQADHLL KQDWCQQLVQ QNALHDLGEA GERWLPTSSS RSLYSPSNRD MVKFSLSVRL        60
     TNSVRTLSVK EAKRGMRLAR LAQTPRWQEL QARYPTFRVM QEDGWAGLRS ADFTLQEESL       120
     LVLRDNLLFS QPDSQTNVLV TLTQAAPDGG DSLLASAVRR LAARLNLPLQ QAAFCWLDAY       180
     CQHVLLPLFS TEADYGLVLL AHQQNILVEM QQDLPVGMLY RDCQGSGFTQ SALPWLAEIG       240
     EAEAENSFSE QQLLRYFPYY LLVNSSLAVT AALAAAGFDS EENLMVRVRD ALSALRTCAK       300
     NTLCLDYVLD SPHWHCKGNF FCYLHDHNEN TIVDPAVIYF DFVNPLHQGV IHGATR           356
//

If you have problems or comments...

PBIL Back to PBIL home page