(data stored in ACNUC9543 zone)

EMBL: CP000308.PE275

CP000308.PE275       Location/Qualifiers
FT   CDS             complement(320000..320608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12244"
FT                   /db_xref="GOA:A0A0E1NMG9"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMG9"
FT                   /protein_id="ABG12244.1"
FT                   /translation="MTIPVETLATDVAAQCFLNALIRETQDWQIVPAAGHQPYPQLHIP
FT                   LSSSHAIHIALCHISPTQHHHYLFPAYLHQQGNDRQDDDTPVKLGIEQLVTLLLEKPTV
FT                   KGELSDDVVARFRQRVLESHDNTQQAINIRLDWPSLRDKPLNFAQAEQGLLAGHAFHPA
FT                   PKSHQPFNEKQAQRYLPILPPASHYAGLQSINATCAAIA"
     MTIPVETLAT DVAAQCFLNA LIRETQDWQI VPAAGHQPYP QLHIPLSSSH AIHIALCHIS        60
     PTQHHHYLFP AYLHQQGNDR QDDDTPVKLG IEQLVTLLLE KPTVKGELSD DVVARFRQRV       120
     LESHDNTQQA INIRLDWPSL RDKPLNFAQA EQGLLAGHAF HPAPKSHQPF NEKQAQRYLP       180
     ILPPASHYAG LQSINATCAA IA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page