(data stored in ACNUC9543 zone)

EMBL: CP000308.PE278

CP000308.PE278       Location/Qualifiers
FT   CDS             complement(323471..324847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12247"
FT                   /db_xref="GOA:A0A0E1NPL4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPL4"
FT                   /protein_id="ABG12247.1"
FT                   /translation="MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGI
FT                   RLTAVAVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIALSPDD
FT                   KNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQATVLRLPSVHTASGD
FT                   TLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLKYNLFIPKDYSPDKDYSPDKNYS
FT                   PDKAWPLVLFMHDAGATSDVTRTTLYQGLGAIAWASPEDQAQRPCFVLAPQYEEIIADD
FT                   DSKTSDMLDTTIDLINVLSEQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVA
FT                   GQWDPALVKPLAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQF
FT                   RQAFEQIEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIREWIFRQQR
FT                   "
     MLTRRKFLMM SAGAGLLLSV PMLARTGVQP AQAATAITQV FGDGIRLTAV AVEYPTEVSA        60
     EGLNPADFHV EGRTVTGVWT STSTNPADIA PSGRYMIIAL SPDDKNATLA EQVQPNSKNN       120
     SNKSANGRGG PGNAGDIPAY DTVYRTAQAT VLRLPSVHTA SGDTLPASEK ALTTQYVENL       180
     IVDDFQQLEF YDEKTGKKLK YNLFIPKDYS PDKDYSPDKN YSPDKAWPLV LFMHDAGATS       240
     DVTRTTLYQG LGAIAWASPE DQAQRPCFVL APQYEEIIAD DDSKTSDMLD TTIDLINVLS       300
     EQYNIDKSRI YATGQSGGCM MTIAMNIKYP DFFAASFLVA GQWDPALVKP LAQQKLWILV       360
     SQDDNKAWPG QNAIIDVLEK EGVQISRAIW DGTWNEEQFR QAFEQIEAEK SPINYVAFRE       420
     GTVIPEGQST EGASGHRNTW RIAYTISPIR EWIFRQQR                               458
//

If you have problems or comments...

PBIL Back to PBIL home page