(data stored in ACNUC9543 zone)

EMBL: CP000308.PE28

CP000308.PE28        Location/Qualifiers
FT   CDS             complement(42926..43816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0028"
FT                   /product="maltose transport system permease protein MalG"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11997"
FT                   /db_xref="GOA:A0A0E1NW61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NW61"
FT                   /protein_id="ABG11997.1"
FT                   /translation="MAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFA
FT                   TGSLIPDQISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAMGIVALST
FT                   TCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGLNTHGGVI
FT                   FAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLLA
FT                   QRWLVGGLTAGGVKG"
     MAMVQPKSQR LRLLGTHFLM LCFIALIMFP LLMVIAISLR PGNFATGSLI PDQISWEHWK        60
     LALGMSVTHA DGSVTPPPFP VMLWLWNSIK IALITAMGIV ALSTTCAYAF ARMRFRGKSA       120
     LLKGMLIFQM FPAVLSLVAL YALFDRIGQY MPFIGLNTHG GVIFAYMGGI ALHVWTIKGY       180
     FETIDNSLEE AAALDGATPW QAFRLVLLPL SVPILAVVFI LSFIAAITEV PVASLLLRDV       240
     NSYTLAVGMQ QYLNPQNYLW GDFAAAAVLS AIPITTVFLL AQRWLVGGLT AGGVKG           296
//

If you have problems or comments...

PBIL Back to PBIL home page