(data stored in ACNUC9543 zone)

EMBL: CP000308.PE283

CP000308.PE283       Location/Qualifiers
FT   CDS             329522..329785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0283"
FT                   /product="insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12252"
FT                   /db_xref="GOA:A0A0E1NZT2"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZT2"
FT                   /protein_id="ABG12252.1"
FT                   /translation="MACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQ
FT                   ARKPEVKGQIVDIAFSGTGVWDTARTLKIGINTVIRTLKNSC"
     MACINVHCPR CDSALVYRHG QNPKGQSRFR CRECRSVFQL TYTYQARKPE VKGQIVDIAF        60
     SGTGVWDTAR TLKIGINTVI RTLKNSC                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page