(data stored in ACNUC9543 zone)

EMBL: CP000308.PE284

CP000308.PE284       Location/Qualifiers
FT   CDS             331730..332230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12253"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMS6"
FT                   /protein_id="ABG12253.1"
FT                   /translation="MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNG
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEP
FT                   ENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
     MSSSSFQNEI PKARINIKLD LHTGGAQKKV ELPLKLLVMG DYSNGQEQRP LSEREKLNIN        60
     KNNFNSVLAE FQPSLKLAVP DTLAGDNTDT AVSLTFNDMK DFEPENVARQ IPQLRALLAM       120
     RNLLRDLKSN LLDNATFRRE LENILKDDAL SDELRAELAA LAPKEG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page