(data stored in ACNUC9543 zone)

EMBL: CP000308.PE287

CP000308.PE287       Location/Qualifiers
FT   CDS             335178..335864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0287"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12256"
FT                   /db_xref="GOA:Q1C9Z2"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q1C9Z2"
FT                   /protein_id="ABG12256.1"
FT                   /translation="MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQR
FT                   CVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHF
FT                   FNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLS
FT                   VQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLAT
FT                   LLPEPV"
     MNPHLTEHPP VGDIDALLQD TWLQVISLRQ GVTCAEGEGQ AFWQRCVADI ERVHQALKDA        60
     GHSEQSCQHI RYAQCALLDE TVKGRGVQDD AYFVWCHSPL QAHFFNTLDA GSQLYERMRA       120
     VLREPAPDRA VLTCFHRVLM LGFLGGYASP AASEREQLID QLSVQVPAFS VAPSRGILAS       180
     AASRNRLGIW LRYWPVRLGL AALMVALLWW GLDHWLSGLL ATLLPEPV                    228
//

If you have problems or comments...

PBIL Back to PBIL home page