(data stored in ACNUC9543 zone)

EMBL: CP000308.PE288

CP000308.PE288       Location/Qualifiers
FT   CDS             335864..337600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0288"
FT                   /product="putative OmpA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12257"
FT                   /db_xref="GOA:A0A0E1NTY9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTY9"
FT                   /protein_id="ABG12257.1"
FT                   /translation="MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICML
FT                   GGSRAGRQAAGASSDPLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQG
FT                   CWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQ
FT                   LRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAV
FT                   QAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVDPLAPQQIIQQQVASLADPVPASLWQ
FT                   HWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLA
FT                   AMVALCSSAWQNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLHRDAGLLDEGYRNGE
FT                   PLRLGLGLYRGERLRPPLLAAIKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAG
FT                   STKMLVTALIDIKAKPGWLIVVAGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPT
FT                   CFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQGPDVKTASQDESDVSTQEM
FT                   EK"
     MSRWWQRGLW LWAGLLAVIL CLAFLPLSPW GRWLMLAWVV LICMLGGSRA GRQAAGASSD        60
     PLFAGLATEN GLLPENSRLP VVLVCGDGLA SWFGRERSHQ SAQGCWLRVD DISTLRQFAR       120
     QLLWQRPEWA AQLAVMMVVN PQQRRDERLL AADLQELRWQ LMQLRRDSRH PVPLLLSSTV       180
     ATSVARDTVW LSQQQTPPLT LWSTVSTPGS LADWQRAESR AVQAERLKQA VLFSSQHDWL       240
     NAQVLPVLQA PNADVDPLAP QQIIQQQVAS LADPVPASLW QHWLAAHTTL TQVAGWHPPP       300
     PAAHDALPLP DFVFSALPLG SGVSSRRRVL RHGVTLLTLA AMVALCSSAW QNRQLLHRVA       360
     FDIRQYHSVA MTDYSPKAQA VAVLHRDAGL LDEGYRNGEP LRLGLGLYRG ERLRPPLLAA       420
     IKSYIPPPPP PPAPPAPKTV RLDSLSLFDV GKFTLNAGST KMLVTALIDI KAKPGWLIVV       480
     AGHTDITGDA QANHILSLKR AEALRDWMLS TSDVSPTCFA VQGYGATRPI ADNDTPDGRA       540
     LNRRVEISLV PQADACQGPD VKTASQDESD VSTQEMEK                               578
//

If you have problems or comments...

PBIL Back to PBIL home page