(data stored in ACNUC9543 zone)

EMBL: CP000308.PE292

CP000308.PE292       Location/Qualifiers
FT   CDS             343590..345743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12261"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Q7"
FT                   /protein_id="ABG12261.1"
FT                   /translation="MMPVSSRRGYPLNTSDSWHGGIHIPHTDSGALPEKVRAIADGTVV
FT                   SFRMPSKPWERDQFPLKYSPLRGTDDGYVLLKHETEIGSGDDGKVVFYSLYMHLKHLEA
FT                   EIKTDAKIYRKAPLGSSGMTDGQNEFHFQIFCDEANTRKLVGRTTGELNINESGRKDVV
FT                   YGDIHFYLPAGTKFYEARPSANIATTTNLNEVHTSAVPLYASMSLSKGAGTMITRQACA
FT                   NAEGAFEPVGSPLVNADGKDYEYNLYKTATSRYPQSPSAGYELLRFGRIINTEHETLVP
FT                   ADAPLWMTVNYPGGQGVVNLAVATVKKFSDADFPHWTGWQLIDDDKDMHSQCNSAAIRK
FT                   LREKDRYAAQSSKLICCIPFEWEKSTIDTRYKWLMTGLPWEQCTPEKTATWQIPGSQES
FT                   KDRILMNEEDYGRFKQHAEALCFDSGALGSGKVWHFDPRGFIENFRKSRWLDEIDLSRV
FT                   YSTTAKDVREKYRTSINFILIKYGMNNPIRTAHFLGQGAIESQNLNLMVEGSVSFSRHP
FT                   DHPSFAEEINGYYADPTDIYGYFHNYEREGNDLGNITKSDLRDSRNNLLTVVIGRDSNN
FT                   RPILTAPQRRTIDSNLSHIGDGMKFRGRGFKQLTGLANYTGYWTYRGWLRSTDYDNSWW
FT                   RNPNRLRVPLIDNPQNISTEPYNCIDSGGQFVAKNGVLRRADAGVTRDSSRSVSMVINR
FT                   WDQQSFERRFQSTQNTYSIVGDE"
     MMPVSSRRGY PLNTSDSWHG GIHIPHTDSG ALPEKVRAIA DGTVVSFRMP SKPWERDQFP        60
     LKYSPLRGTD DGYVLLKHET EIGSGDDGKV VFYSLYMHLK HLEAEIKTDA KIYRKAPLGS       120
     SGMTDGQNEF HFQIFCDEAN TRKLVGRTTG ELNINESGRK DVVYGDIHFY LPAGTKFYEA       180
     RPSANIATTT NLNEVHTSAV PLYASMSLSK GAGTMITRQA CANAEGAFEP VGSPLVNADG       240
     KDYEYNLYKT ATSRYPQSPS AGYELLRFGR IINTEHETLV PADAPLWMTV NYPGGQGVVN       300
     LAVATVKKFS DADFPHWTGW QLIDDDKDMH SQCNSAAIRK LREKDRYAAQ SSKLICCIPF       360
     EWEKSTIDTR YKWLMTGLPW EQCTPEKTAT WQIPGSQESK DRILMNEEDY GRFKQHAEAL       420
     CFDSGALGSG KVWHFDPRGF IENFRKSRWL DEIDLSRVYS TTAKDVREKY RTSINFILIK       480
     YGMNNPIRTA HFLGQGAIES QNLNLMVEGS VSFSRHPDHP SFAEEINGYY ADPTDIYGYF       540
     HNYEREGNDL GNITKSDLRD SRNNLLTVVI GRDSNNRPIL TAPQRRTIDS NLSHIGDGMK       600
     FRGRGFKQLT GLANYTGYWT YRGWLRSTDY DNSWWRNPNR LRVPLIDNPQ NISTEPYNCI       660
     DSGGQFVAKN GVLRRADAGV TRDSSRSVSM VINRWDQQSF ERRFQSTQNT YSIVGDE          717
//

If you have problems or comments...

PBIL Back to PBIL home page