(data stored in ACNUC9543 zone)

EMBL: CP000308.PE297

CP000308.PE297       Location/Qualifiers
FT   CDS             350771..351538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P0H6"
FT                   /protein_id="ABG12266.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
     MINIKKLTLK YFYILFFTPH LAHATYYNEV SFDDYIVLLD KNENAILHVK KNHTDIQCVI        60
     KNWNIKYNNG AGVISLTTDK KAILLANTQA YLYVDEVINC KEGGVSLHKV PVPNSPPFGT       120
     VIDLNFDKKI YLSVVLEDIR TLSYTAIVSK FDSNKNIINA KGFENKQTTN KDNSFYLEGS       180
     SGGYGGKISI NGKYIFPVNL DCSSDSFPGV WDLENKKRVV FSSHKNSSIT IDEKCHKLFN       240
     GVASLEELGG ELVSK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page