(data stored in ACNUC9543 zone)

EMBL: CP000308.PE298

CP000308.PE298       Location/Qualifiers
FT   CDS             351634..351909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0299"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12267"
FT                   /db_xref="GOA:A0A0E1NS18"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS18"
FT                   /protein_id="ABG12267.1"
FT                   /translation="MAKVDVKCPFCEQFHPVKKHGPGRTGHQRYRCQACRRSFQLEYEY
FT                   RACHPGMKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
     MAKVDVKCPF CEQFHPVKKH GPGRTGHQRY RCQACRRSFQ LEYEYRACHP GMKEQIVDLA        60
     MNNAGIRDTA RALHISINAV MRTLKNSRRS V                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page