(data stored in ACNUC9543 zone)

EMBL: CP000308.PE30

CP000308.PE30        Location/Qualifiers
FT   CDS             complement(45594..46805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0030"
FT                   /product="maltose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11999"
FT                   /db_xref="GOA:A0A0E1P2V5"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2V5"
FT                   /protein_id="ABG11999.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITGRQTVEAALNDAAT
FT                   RITK"
     MTRSFTKSGI GKTARVLALS ALTTLVLSSS AFAKIEEGKL VIWINGDKGY NGLAEVGKKF        60
     EKDTGIKVTI EHPDKLEEKF PQVAATGDGP DIIFWAHDRF GGYAQSGLLA ELTPSKAFQE       120
     KLFPFTWDAV RFNGKLIGYP VAVEALSLIY NKDLVKEAPK TWEEIPALDK TLRANGKSAI       180
     MWNLQEPYFT WPVIAADGGY AFKFENGVYD AKNVGVNNAG AQAGLQFIVD LVKNKHINAD       240
     TDYSIAEAAF NKGETAMTIN GPWAWSNIDK SKINYGVTLL PTFHGQPSKP FVGVLTAGIN       300
     AASPNKELAT EFLENYLITD QGLAEVNKDK PLGAVALKSF QEQLAKDPRI AATMDNATNG       360
     EIMPNIPQMA AFWYATRSAV LNAITGRQTV EAALNDAATR ITK                         403
//

If you have problems or comments...

PBIL Back to PBIL home page