(data stored in ACNUC9543 zone)

EMBL: CP000308.PE302

CP000308.PE302       Location/Qualifiers
FT   CDS             354731..354883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3R4"
FT                   /protein_id="ABG12271.1"
FT                   /translation="MVDAETSSPITQACISAGETCAFNDINLPALHQCSALCDVIDMPK
FT                   WQPHT"
     MVDAETSSPI TQACISAGET CAFNDINLPA LHQCSALCDV IDMPKWQPHT                   50
//

If you have problems or comments...

PBIL Back to PBIL home page