(data stored in ACNUC9543 zone)

EMBL: CP000308.PE304

CP000308.PE304       Location/Qualifiers
FT   CDS             357621..358580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0305"
FT                   /product="putative sugar ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12273"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NU87"
FT                   /protein_id="ABG12273.1"
FT                   /translation="MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEY
FT                   MKIHAKEKGYTLITTDARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRA
FT                   GVPTVILDSDIALEAPVITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVG
FT                   QARRDNFLLGVAEAQLRKYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYS
FT                   EMDDMALGAIRALKAANKLDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLE
FT                   VIGQYQAGQTSFPDYVYIPSILITKDNVDKYYKEDSIF"
     MKKRLIGLLL AGVTISMSVS AAEPLKIGFA NRTLNGAFFN GLTEYMKIHA KEKGYTLITT        60
     DARGDLNKQI ADVEDMLSQG INYLILNPQD PQAGLRITEI AKRAGVPTVI LDSDIALEAP       120
     VITRVQANNA KNNNLIGEYA VGQFGDKPMN CIFLSGNQGN LVGQARRDNF LLGVAEAQLR       180
     KYNRTNVNFL SQGWGNWDQQ GGLKAMEDII VAQGDKINCV YSEMDDMALG AIRALKAANK       240
     LDNVKVYAHD GYKKGLEAVK KGELQATASN NPDLLTSTVL EVIGQYQAGQ TSFPDYVYIP       300
     SILITKDNVD KYYKEDSIF                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page