(data stored in ACNUC9543 zone)

EMBL: CP000308.PE305

CP000308.PE305       Location/Qualifiers
FT   CDS             358626..360125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0306"
FT                   /product="putative sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12274"
FT                   /db_xref="GOA:A0A0E1NVL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVL7"
FT                   /protein_id="ABG12274.1"
FT                   /translation="MDQYAIEVIQVTKSFGGIHALKSINLQIRTGSIHAIIGENGAGKS
FT                   TLMKILSGIYTKDSGRIMIHGEEKNFTSPIHSKESRIGIIYQELALSPDLTVAENIFLD
FT                   DLGFGTGMINWKRLNEKASLILNELGFQIDPRARVGDLSVAYQQMVEIAKSLAKDVNIL
FT                   ILDEPSAVLSGKEVAILFTQLRKLKARGVTIIYISHRLEELMVIADVITVIKDGETVKT
FT                   LDPQSCSEDEIITSMVGRKLESLYPEKNVPGNEVVLEVKALSTRALLHGINLTLHKGEI
FT                   VGLAGLVGAGRSEVARCLFGIDKIAGGTVSKAGTPIQINHPSQAMSHGIGLVPESRKEQ
FT                   GAILVRPIRENMTLSNLKAVSGWMGFIRRRQERETSQKLQQKLAIKLGSVEDPIASLSG
FT                   GNQQKVVIAKWLNTDCHILILDEPTRGVDVGAKAEIYNIIHQLAERGYSILVISSEMVE
FT                   VINLCHRIYVMSEGRITKELQHDEISEENIMRYAIPKRETI"
     MDQYAIEVIQ VTKSFGGIHA LKSINLQIRT GSIHAIIGEN GAGKSTLMKI LSGIYTKDSG        60
     RIMIHGEEKN FTSPIHSKES RIGIIYQELA LSPDLTVAEN IFLDDLGFGT GMINWKRLNE       120
     KASLILNELG FQIDPRARVG DLSVAYQQMV EIAKSLAKDV NILILDEPSA VLSGKEVAIL       180
     FTQLRKLKAR GVTIIYISHR LEELMVIADV ITVIKDGETV KTLDPQSCSE DEIITSMVGR       240
     KLESLYPEKN VPGNEVVLEV KALSTRALLH GINLTLHKGE IVGLAGLVGA GRSEVARCLF       300
     GIDKIAGGTV SKAGTPIQIN HPSQAMSHGI GLVPESRKEQ GAILVRPIRE NMTLSNLKAV       360
     SGWMGFIRRR QERETSQKLQ QKLAIKLGSV EDPIASLSGG NQQKVVIAKW LNTDCHILIL       420
     DEPTRGVDVG AKAEIYNIIH QLAERGYSIL VISSEMVEVI NLCHRIYVMS EGRITKELQH       480
     DEISEENIMR YAIPKRETI                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page