(data stored in ACNUC9543 zone)

EMBL: CP000308.PE308

CP000308.PE308       Location/Qualifiers
FT   CDS             complement(363361..364461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12277"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ90"
FT                   /protein_id="ABG12277.1"
FT                   /translation="MRLLLLIFLLCTWAVSAKTITDITGQRIEIPDNPQRIVLGESRML
FT                   YTLALLEPGYPAARVVGWPLDLKKYDPQSWALYTDKFPQMTHIPALGSTGLRDINPEKV
FT                   LELAPDLVILPVLAKTTHEEIALISLLKQAHIPVIRVDLRVDLLNHTIPSLRLLGEALN
FT                   RQDRAEAFISLYQSHMDRIHQRIAAYQGPHPSVLLQLHLGRGDECCTTTLKGNLGQLLE
FT                   FAGGNNIAAAQVKGVFGQLSEEYVLARSPEIYIATGMATAGSQAKTLALGPQVSTAQAQ
FT                   ESFRRVIATQSKLQHLPAIQNGHAWGLWHNFYLSPLHVVAAEFFAKTLYPHLFADVSPQ
FT                   DTLQTIYQQFLPLDFTGTFWSHLDNE"
     MRLLLLIFLL CTWAVSAKTI TDITGQRIEI PDNPQRIVLG ESRMLYTLAL LEPGYPAARV        60
     VGWPLDLKKY DPQSWALYTD KFPQMTHIPA LGSTGLRDIN PEKVLELAPD LVILPVLAKT       120
     THEEIALISL LKQAHIPVIR VDLRVDLLNH TIPSLRLLGE ALNRQDRAEA FISLYQSHMD       180
     RIHQRIAAYQ GPHPSVLLQL HLGRGDECCT TTLKGNLGQL LEFAGGNNIA AAQVKGVFGQ       240
     LSEEYVLARS PEIYIATGMA TAGSQAKTLA LGPQVSTAQA QESFRRVIAT QSKLQHLPAI       300
     QNGHAWGLWH NFYLSPLHVV AAEFFAKTLY PHLFADVSPQ DTLQTIYQQF LPLDFTGTFW       360
     SHLDNE                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page