(data stored in ACNUC9543 zone)

EMBL: CP000308.PE31

CP000308.PE31        Location/Qualifiers
FT   CDS             47393..47629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRQ9"
FT                   /protein_id="ABG12000.1"
FT                   /translation="MRLIITLLDQYVEALFNVQPYTQAATPSGATLPLAWRHGAQRESH
FT                   QGTGGNQWVMPGFASTVFLHSDSYEKLFAQAKE"
     MRLIITLLDQ YVEALFNVQP YTQAATPSGA TLPLAWRHGA QRESHQGTGG NQWVMPGFAS        60
     TVFLHSDSYE KLFAQAKE                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page