(data stored in ACNUC9543 zone)

EMBL: CP000308.PE313

CP000308.PE313       Location/Qualifiers
FT   CDS             368624..368950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12282"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPI4"
FT                   /protein_id="ABG12282.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
     MAKNRSRRLR KKMHIDEFQE LGFSVQWAFD EGTSVDVIDE TVDAFIDEVI EANGLAFDGS        60
     GYLQWEGLIC LQEIGHCTDE HRALVTKWLE ARKLKNVETS ELFDIWWD                    108
//

If you have problems or comments...

PBIL Back to PBIL home page