(data stored in ACNUC9543 zone)

EMBL: CP000308.PE315

CP000308.PE315       Location/Qualifiers
FT   CDS             370099..370629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12284"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NVF3"
FT                   /protein_id="ABG12284.1"
FT                   /translation="MLHKIKVLRTAGLALLMLTAGQAQAEYQCSVKPQDDVIISPQSVQ
FT                   IVGASGNLQISPDGDVTRNGKTLTLTDAQRQQAFRYQTALRKDLPWIDQGAQQRLEKAR
FT                   VSLDKVIVQQLGSSSNVRNRLTTLSEQLKQQMARIIEKRSDGLAFHHQAIAQVEKEAVS
FT                   WSSRAWVACCRIA"
     MLHKIKVLRT AGLALLMLTA GQAQAEYQCS VKPQDDVIIS PQSVQIVGAS GNLQISPDGD        60
     VTRNGKTLTL TDAQRQQAFR YQTALRKDLP WIDQGAQQRL EKARVSLDKV IVQQLGSSSN       120
     VRNRLTTLSE QLKQQMARII EKRSDGLAFH HQAIAQVEKE AVSWSSRAWV ACCRIA           176
//

If you have problems or comments...

PBIL Back to PBIL home page