(data stored in ACNUC9543 zone)

EMBL: CP000308.PE319

CP000308.PE319       Location/Qualifiers
FT   CDS             complement(381976..382569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12288"
FT                   /db_xref="GOA:A0A0E1NXJ4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXJ4"
FT                   /protein_id="ABG12288.1"
FT                   /translation="MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLT
FT                   FIENAILKARHAAQTTGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLV
FT                   ALQNVPDEKRGAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVP
FT                   ALGKTAAELTREEKHAVSHRGQALKLMLDALRDA"
     MQKIVLATGN PGKVRELANL LADFGLDVVA QTELGVESAE ETGLTFIENA ILKARHAAQT        60
     TGLPAIADDS GLAVDALGGA PGIYSARYAG TDASDQENLE KLLVALQNVP DEKRGAQFHC       120
     VLVYMRHAED PTPLVFHGQW PGVIAHQPAG AAGFGYDPIF YVPALGKTAA ELTREEKHAV       180
     SHRGQALKLM LDALRDA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page