(data stored in ACNUC9543 zone)

EMBL: CP000308.PE321

CP000308.PE321       Location/Qualifiers
FT   CDS             complement(382956..383510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0322"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12290"
FT                   /db_xref="GOA:A0A0E1NZU9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZU9"
FT                   /protein_id="ABG12290.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
     MLTLTFLAKT VIDLYVMVLL LRIWMQWVHS DFYNPLSQFV VKITQPIVGP LRRVVPSMGP        60
     IDSASLLLAF LLMTIKYPLL LLIDSGSLSL SIYNLLFGLI ALVKAVGYLI FWVMIIRALM       120
     SWISQGRSPV DYLLLQLTEP LMAPIRRILP AMGGIDFSAM VVILILYLLN FLGMDLFGAM       180
     WVML                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page