(data stored in ACNUC9543 zone)

EMBL: CP000308.PE330

CP000308.PE330       Location/Qualifiers
FT   CDS             complement(390972..391703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12299"
FT                   /db_xref="GOA:A0A0E1NLQ1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLQ1"
FT                   /protein_id="ABG12299.1"
FT                   /translation="MRIPRIYHPQPLQANTELALTDEAANHVGRVLRMTEGQSLQLFDG
FT                   SNQIFDAEIIRADKKNLIVRLAEGQWEDRESPLNLHLGQVISRGEKMEFTVQKSIELGV
FT                   NVITPLFSARCGVKLDGERLTKKIQQWQKIAIAACEQCGRNTIPEIRDAMQLADWCAES
FT                   DDSLKLNLHPRASNSINTLPSSLNKVRLLIGPEGGLSADEIAMTSRLGFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
     MRIPRIYHPQ PLQANTELAL TDEAANHVGR VLRMTEGQSL QLFDGSNQIF DAEIIRADKK        60
     NLIVRLAEGQ WEDRESPLNL HLGQVISRGE KMEFTVQKSI ELGVNVITPL FSARCGVKLD       120
     GERLTKKIQQ WQKIAIAACE QCGRNTIPEI RDAMQLADWC AESDDSLKLN LHPRASNSIN       180
     TLPSSLNKVR LLIGPEGGLS ADEIAMTSRL GFTDILLGPR VLRTETTALT AITALQVRFG       240
     DLG                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page