(data stored in ACNUC9543 zone)

EMBL: CP000308.PE333

CP000308.PE333       Location/Qualifiers
FT   CDS             complement(392760..393317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12302"
FT                   /db_xref="GOA:A0A0H2Y3T3"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3T3"
FT                   /protein_id="ABG12302.1"
FT                   /translation="MSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQHLG
FT                   TAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQF
FT                   GRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKVLR
FT                   GESEYRCRQCGEKLQFITINPD"
     MSACIWLSTV LFFRIMSTLR IPIALQQAVM QCLRHYLQLA NQHLGTAYPE PKVNYHQRGT        60
     NAGSAYLQSF EIRLNPVLLL ENKQPFIDEV VPHELAHLLV YRQFGRVAPH GKEWRWMMEQ       120
     VLKVPASRTH QFEVASVRSK TFNYQCKCQQ HALTIRRHNK VLRGESEYRC RQCGEKLQFI       180
     TINPD                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page