(data stored in ACNUC9543 zone)

EMBL: CP000308.PE349

CP000308.PE349       Location/Qualifiers
FT   CDS             411425..412225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12318"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y479"
FT                   /protein_id="ABG12318.1"
FT                   /translation="MHILGGTVKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSG
FT                   TASVEATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFLNKSGIEKKDVKAANIRT
FT                   QPEYDYQKSGEAVLKGYRAVRQVQVTLRQLDKLNDLLDGALKSGLNEIRAVELGVASPE
FT                   TYREQARKKAIENTITQAGALADGFKVKLGPVYSIRYHIANYQPMPVARMYKSAGAASD
FT                   TAVEQTYEQQTINFDDQVDVVFELQTGANPASIAATANKTVAAQ"
     MHILGGTVKL KTLALAAMIG LGTLPLALQA QAAEVPEGPH VVTSGTASVE ATPDIATIAI        60
     EVSVSAKDAA DAKKQVDTRV AQYFDFLNKS GIEKKDVKAA NIRTQPEYDY QKSGEAVLKG       120
     YRAVRQVQVT LRQLDKLNDL LDGALKSGLN EIRAVELGVA SPETYREQAR KKAIENTITQ       180
     AGALADGFKV KLGPVYSIRY HIANYQPMPV ARMYKSAGAA SDTAVEQTYE QQTINFDDQV       240
     DVVFELQTGA NPASIAATAN KTVAAQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page