(data stored in ACNUC9543 zone)

EMBL: CP000308.PE354

CP000308.PE354       Location/Qualifiers
FT   CDS             complement(416915..417244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0355"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12323"
FT                   /db_xref="GOA:Q1CB49"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR023771"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB49"
FT                   /protein_id="ABG12323.1"
FT                   /translation="MSAQPVDIQVFGRSLRVNCPPEQQDALNMAAEDLSQRLQDLKVRT
FT                   RVNNTEQLVFIAALNVCHELAQERLKTRDYASNMEQRIRMLQQTIEQALLEQGRISDRQ
FT                   DTQFE"
     MSAQPVDIQV FGRSLRVNCP PEQQDALNMA AEDLSQRLQD LKVRTRVNNT EQLVFIAALN        60
     VCHELAQERL KTRDYASNME QRIRMLQQTI EQALLEQGRI SDRQDTQFE                   109
//

If you have problems or comments...

PBIL Back to PBIL home page