(data stored in ACNUC9543 zone)

EMBL: CP000308.PE355

CP000308.PE355       Location/Qualifiers
FT   CDS             417581..418159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12324"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB48"
FT                   /protein_id="ABG12324.1"
FT                   /translation="MSIENTLPTYPSLALALSQQAVALTPAEMHGLISGMLCGGSKDNG
FT                   WQTLVHDLTNEGVAFPQALSLPLQQLHEATQEALENEGFMFQLLIPEGEDVTVFDRADA
FT                   LSGWVNHFLLGLGMLQPKLAQVKDEVGEAIDDLRNIAQLGYDEDEDQEELAQSLEEVVE
FT                   YVRVAAILCHIEFTQQKPTAPEMHKPTLH"
     MSIENTLPTY PSLALALSQQ AVALTPAEMH GLISGMLCGG SKDNGWQTLV HDLTNEGVAF        60
     PQALSLPLQQ LHEATQEALE NEGFMFQLLI PEGEDVTVFD RADALSGWVN HFLLGLGMLQ       120
     PKLAQVKDEV GEAIDDLRNI AQLGYDEDED QEELAQSLEE VVEYVRVAAI LCHIEFTQQK       180
     PTAPEMHKPT LH                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page