(data stored in ACNUC9543 zone)

EMBL: CP000308.PE365

CP000308.PE365       Location/Qualifiers
FT   CDS             429625..431565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0366"
FT                   /product="putative surface protein"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12334"
FT                   /db_xref="GOA:A0A0H2Y490"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y490"
FT                   /protein_id="ABG12334.1"
FT                   /translation="MDGPSVGPITSPNCNTPSIGIINTNAGQLFVGGTGAAVSGTLGPT
FT                   FWTGTFATPVGTSNTATAYGMVVQSGGAYITGNTYVQGGLFLNGQKATNLAPATISSTS
FT                   TDAVVGSQLYNLVQDGTRYFHANSVNPTDSLASGLETIAVGPATVVSGDNGVGIGNTAL
FT                   VGAAATGGIAIGFGTQVTAAGATAIGSAAQAQGAQSLALGAGAVTSQANSIALGAASIN
FT                   TVGAQSSYSAYALTAPQASVGELGIGTALGNRKITGVAAGSASSDAVNVAQLTAVGDQV
FT                   QQNTANITSLGGRVTTIEGSMASIANGGGVKYFHANSTQPDSVASGTNSVAIGPASLAS
FT                   GNAALASGAGAVAIGDGAAASADGSVAIGQGSGDNGRGVENYIGKYSNASNTSSGTVSV
FT                   GNTATGETRTVSNVADGLQATDAVNLRQLDGIAASIVVVENNVSGLQNGTDGMFQVNNS
FT                   SGLAKPSATGANSATGGAGSVASGNNSTAFGSGAKATAANSAALGANSVADRANSVSVG
FT                   SVGNERQITNVAPATQGTDAVNFDQLKSISNQTNAYTNQRYSELKQDLRKQNSVLSAGI
FT                   ASAMSMASLTQPYTSGSSMTTIGAASYRGQSALSLGVSSISDSGRWVSKLQASSNTQGD
FT                   FGIGVGVGYQW"
     MDGPSVGPIT SPNCNTPSIG IINTNAGQLF VGGTGAAVSG TLGPTFWTGT FATPVGTSNT        60
     ATAYGMVVQS GGAYITGNTY VQGGLFLNGQ KATNLAPATI SSTSTDAVVG SQLYNLVQDG       120
     TRYFHANSVN PTDSLASGLE TIAVGPATVV SGDNGVGIGN TALVGAAATG GIAIGFGTQV       180
     TAAGATAIGS AAQAQGAQSL ALGAGAVTSQ ANSIALGAAS INTVGAQSSY SAYALTAPQA       240
     SVGELGIGTA LGNRKITGVA AGSASSDAVN VAQLTAVGDQ VQQNTANITS LGGRVTTIEG       300
     SMASIANGGG VKYFHANSTQ PDSVASGTNS VAIGPASLAS GNAALASGAG AVAIGDGAAA       360
     SADGSVAIGQ GSGDNGRGVE NYIGKYSNAS NTSSGTVSVG NTATGETRTV SNVADGLQAT       420
     DAVNLRQLDG IAASIVVVEN NVSGLQNGTD GMFQVNNSSG LAKPSATGAN SATGGAGSVA       480
     SGNNSTAFGS GAKATAANSA ALGANSVADR ANSVSVGSVG NERQITNVAP ATQGTDAVNF       540
     DQLKSISNQT NAYTNQRYSE LKQDLRKQNS VLSAGIASAM SMASLTQPYT SGSSMTTIGA       600
     ASYRGQSALS LGVSSISDSG RWVSKLQASS NTQGDFGIGV GVGYQW                      646
//

If you have problems or comments...

PBIL Back to PBIL home page