(data stored in ACNUC9543 zone)

EMBL: CP000308.PE369

CP000308.PE369       Location/Qualifiers
FT   CDS             complement(434503..435495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12338"
FT                   /db_xref="GOA:Q1CB34"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR023758"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB34"
FT                   /protein_id="ABG12338.1"
FT                   /translation="MAYHTPFAAQPPVASSGLPLTLISLDDWALVTLTGADRVKYLQGQ
FT                   VTADIDALSADQHVLCAHCDAKGKMWSNLRLFYRGEGLAFIERRSLLDNQLSELKKYAV
FT                   FSKVVIEPQPDAVLIGVAGSQAKTALAEIFTELPSAEHPVTQMGNSTLLHFSLPAERFL
FT                   LVTDTEQAQQLVEKLAGRAQFNDSKQWLALDIEAGFPIIDAANSAQFIPQATNIQALNG
FT                   ISFTKGCYTGQEMVARAKYRGANKRALYWLAGNASRVPAAGEDLEWQLGENWRRTGTVL
FT                   SAIQLNDGTVWVQAVLNNDLAADSVLRVRDDALGTLAIQPLPYSLAEDK"
     MAYHTPFAAQ PPVASSGLPL TLISLDDWAL VTLTGADRVK YLQGQVTADI DALSADQHVL        60
     CAHCDAKGKM WSNLRLFYRG EGLAFIERRS LLDNQLSELK KYAVFSKVVI EPQPDAVLIG       120
     VAGSQAKTAL AEIFTELPSA EHPVTQMGNS TLLHFSLPAE RFLLVTDTEQ AQQLVEKLAG       180
     RAQFNDSKQW LALDIEAGFP IIDAANSAQF IPQATNIQAL NGISFTKGCY TGQEMVARAK       240
     YRGANKRALY WLAGNASRVP AAGEDLEWQL GENWRRTGTV LSAIQLNDGT VWVQAVLNND       300
     LAADSVLRVR DDALGTLAIQ PLPYSLAEDK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page