(data stored in ACNUC9543 zone)

EMBL: CP000308.PE371

CP000308.PE371       Location/Qualifiers
FT   CDS             436059..436484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12340"
FT                   /db_xref="GOA:A0A0H2Y494"
FT                   /db_xref="InterPro:IPR009883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y494"
FT                   /protein_id="ABG12340.1"
FT                   /translation="MAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVL
FT                   LTLVVFECIRSQKRIKSCQGEIRLKPGNLVRWKRHEWTVVKPPWITRYGVLLHLQQTGG
FT                   HATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM"
     MAQWRCNLRV SWHTQLFSLL AHGILVILTL VAPWPLGYTA LWLVLLTLVV FECIRSQKRI        60
     KSCQGEIRLK PGNLVRWKRH EWTVVKPPWI TRYGVLLHLQ QTGGHATRKR LWLSADSMSE       120
     DEWRQLCLLL RHSFESDDGT M                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page