(data stored in ACNUC9543 zone)

EMBL: CP000308.PE373

CP000308.PE373       Location/Qualifiers
FT   CDS             437207..438625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0374"
FT                   /product="putative histidine kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12342"
FT                   /db_xref="GOA:A0A0E1NX66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX66"
FT                   /protein_id="ABG12342.1"
FT                   /translation="MKIGVRLLLGYFLIVAIAGYFVIRIFLQEVKPGVRRATEGTLVDT
FT                   ATLLAQFARQDILQNKVADGQLAQAFSSLNLRPIGANIEGIRKDRNEYRVYLTDTDGQV
FT                   IFDSSGRALGQDYSRWNDVWLTLRGEYGARSSRTDPDDAESSVMYVAAPVIVENRIVGV
FT                   LSIGKPNLSMVPVIKRSERKILFAGGLLLGIALLIGLGFVWWINRAIGKLVDYAERVAE
FT                   GQAVALPAMGSSELNDLALALESMRLKLDGKAYIEQYVHTLTHELKSPLAAISGAAELL
FT                   RESPPPETAQRFLINIEQQSARIQQLVDKMLVQARLESRVDLQLSPLEISHILKQSFSA
FT                   KEAQAVSRGVTLRLKSVDNAMLIGDGLLLSQALNNLIDNALDFTPAGGEISVSGERQDD
FT                   TYLITVEDSGSGIPGYAQEKIFDRFYSLPRANSVKSTGLGLNFVREVAAIHQGSICLEN
FT                   RLPQGVSARLTLPL"
     MKIGVRLLLG YFLIVAIAGY FVIRIFLQEV KPGVRRATEG TLVDTATLLA QFARQDILQN        60
     KVADGQLAQA FSSLNLRPIG ANIEGIRKDR NEYRVYLTDT DGQVIFDSSG RALGQDYSRW       120
     NDVWLTLRGE YGARSSRTDP DDAESSVMYV AAPVIVENRI VGVLSIGKPN LSMVPVIKRS       180
     ERKILFAGGL LLGIALLIGL GFVWWINRAI GKLVDYAERV AEGQAVALPA MGSSELNDLA       240
     LALESMRLKL DGKAYIEQYV HTLTHELKSP LAAISGAAEL LRESPPPETA QRFLINIEQQ       300
     SARIQQLVDK MLVQARLESR VDLQLSPLEI SHILKQSFSA KEAQAVSRGV TLRLKSVDNA       360
     MLIGDGLLLS QALNNLIDNA LDFTPAGGEI SVSGERQDDT YLITVEDSGS GIPGYAQEKI       420
     FDRFYSLPRA NSVKSTGLGL NFVREVAAIH QGSICLENRL PQGVSARLTL PL               472
//

If you have problems or comments...

PBIL Back to PBIL home page