(data stored in ACNUC9543 zone)

EMBL: CP000308.PE376

CP000308.PE376       Location/Qualifiers
FT   CDS             440918..441817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0377"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12345"
FT                   /db_xref="GOA:A0A0E1NX25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NX25"
FT                   /protein_id="ABG12345.1"
FT                   /translation="MKQQDNPLIEQFLDALWLERNLAENTLASYRLDLHALVGWLTHHN
FT                   SDLLRASPQDLQSFLAERIEGGYKATSSARLLSAMRRLFQYLYREKLREDDPTALLSSP
FT                   KLPQRLPKDLSEAQVDALLNSPNVDIPLELRDKAMLEVLYATGLRVSELVGLTISDVSL
FT                   RQGVVRVIGKGNKERLVPLGEEAVYWIENYMEHGRPWLVNGASLDVLFPSNRSQQMTRQ
FT                   TFWHRIKHYAILAGIDSERLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYT
FT                   HVATERLRQLHQQHHPRA"
     MKQQDNPLIE QFLDALWLER NLAENTLASY RLDLHALVGW LTHHNSDLLR ASPQDLQSFL        60
     AERIEGGYKA TSSARLLSAM RRLFQYLYRE KLREDDPTAL LSSPKLPQRL PKDLSEAQVD       120
     ALLNSPNVDI PLELRDKAML EVLYATGLRV SELVGLTISD VSLRQGVVRV IGKGNKERLV       180
     PLGEEAVYWI ENYMEHGRPW LVNGASLDVL FPSNRSQQMT RQTFWHRIKH YAILAGIDSE       240
     RLSPHVLRHA FATHLLNHGA DLRVVQMLLG HSDLSTTQIY THVATERLRQ LHQQHHPRA        299
//

If you have problems or comments...

PBIL Back to PBIL home page